PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G13570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 397aa    MW: 43208.4 Da    PI: 10.4284
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G13570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.74.6e-212066349
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     i++  +rqvtfskRr+g++KKA+EL +LC+a vav++fs+ ++++ +
  LPERR06G13570.1 20 IDDVGRRQVTFSKRRHGLFKKASELATLCGAPVAVVVFSKADNVFAF 66
                     88999***********************************9998876 PP

2SRF-TF61.21.2e-19220262345
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                      i++++ rqvtf+kRr+g++KKA+EL +LC+a vav+ fs+ g+
  LPERR06G13570.1 220 IQDHTARQVTFTKRRQGMMKKASELATLCGAHVAVVAFSEVGN 262
                      899************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-251069IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.8291070IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.55E-231182IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001266IPR002100Transcription factor, MADS-box
PfamPF003191.9E-212066IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-23210285IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.675210270IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-27210269IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-16212232IPR002100Transcription factor, MADS-box
PfamPF003191.5E-20220266IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-16232247IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-16247268IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MVRPRGRPSK GRQRIAIRHI DDVGRRQVTF SKRRHGLFKK ASELATLCGA PVAVVVFSKA  60
DNVFAFGDPT ASAVLRRYAP SSSPAPLSDA ASDAAGAAAP EELDSLRRAA EETKAQVASE  120
KARMRGVAEM ITRAVREGRE HWWDADVEAL GMAELPEFAR ALEALRGSVQ RQSNTMLAIA  180
TTTPPPLPAQ QESPELNQEE GATMVRPPSK GRQKIEMRYI QDHTARQVTF TKRRQGMMKK  240
ASELATLCGA HVAVVAFSEV GNAFGFGDPC ASAVLRRYAA ATLTDDADAA FSAATTGELD  300
ALRRATEETK VQMASEKARM SRVAGRIKRA VKPGRKHWWD ADVEALGMAE LPEFVRALEK  360
LRGSVKRQAE RMPAAATTTP PPLQCNGMIR LLDDVNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642334.16e-61PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0D9WQP10.0A0A0D9WQP1_9ORYZ; Uncharacterized protein
STRINGORGLA06G0135200.19e-66(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-29AGAMOUS-like 61